DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG5246

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:269 Identity:83/269 - (30%)
Similarity:133/269 - (49%) Gaps:25/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLIATFLALLALTNGAVIPI-----------GLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRS- 55
            |::.:.|.:|:..:...:.|           .::|:|     |::||..|.....|:|||:..: 
  Fly     4 LVLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPET-----RVIGGVDSPTGFAPYQVSIMNTF 63

  Fly    56 GSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKIN 120
            |.|.||||||:...|:|||||::.|  :..|:|..|:...|..|....|...|.|.:::..:..|
  Fly    64 GEHVCGGSIIAPQWILTAAHCMEWP--IQYLKIVTGTVDYTRPGAEYLVDGSKIHCSHDKPAYHN 126

  Fly   121 DIGVVRLKTKLTFGSTIKAITMAS--ATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQ 183
            ||.::.....:.:....:.|.:||  :.|..|...:::|||.|.|.|..|..|..:|...:....
  Fly   127 DIALIHTAKPIVYDDLTQPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDN 191

  Fly   184 CGSSTYGYGSFIKATMICA-AATNKDACQGDSGGPLVSGGQ-LVGVVSWGRDCAVANYPGVYANI 246
            |.|.... .:::....:|. ....:.:|.||||||||...| |||||:||..||: .||.|:.::
  Fly   192 CQSRVRN-ANWLSEGHVCTFTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACAI-GYPDVFGSV 254

  Fly   247 AELRDWVLQ 255
            |...||:.|
  Fly   255 AYYHDWIEQ 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 75/223 (34%)
Tryp_SPc 35..253 CDD:238113 74/222 (33%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 75/223 (34%)
Tryp_SPc 42..263 CDD:238113 75/224 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.