DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG4053

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:232 Identity:74/232 - (31%)
Similarity:113/232 - (48%) Gaps:18/232 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LGGRIVGGTASSIEDRPWQVSLQRS-GSHFCGGSIISNNIIVTAAHC-LDTPTTVSNLRIRAGSN 93
            |..|||||..:.....|:|||:|.. .:|.|.|.|::...|:||.|| ||  .::.:|||..|:|
  Fly    31 LDNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCALD--FSIEDLRIIVGTN 93

  Fly    94 KRTYGGVLVEVAAIKAH------EAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSA 152
            .|...|..:.......|      ..||     |||.::.:...:.|....:.:.::...|..||.
  Fly    94 DRLEPGQTLFPDEALVHCLYDIPYVYN-----NDIALIHVNESIIFNDRTQIVELSREQPPAGST 153

  Fly   153 ASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICA-AATNKDACQGDSGG 216
            .:::|||...:..|:...|..::..|:...:| ...:.:...|....||. ....:.||.|||||
  Fly   154 VTLTGWGAPESSYPTVQYLQTLNLTIIAHEEC-RERWDFHDGIDIGHICTFTREGEGACSGDSGG 217

  Fly   217 PLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWV 253
            ||:..|:|||:|:|||.|.| ..|.:|||....:||:
  Fly   218 PLMWEGKLVGLVNWGRACGV-GMPDMYANTVYYQDWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 72/227 (32%)
Tryp_SPc 35..253 CDD:238113 71/226 (31%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 72/227 (32%)
Tryp_SPc 35..256 CDD:238113 72/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.