DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG17475

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:229 Identity:71/229 - (31%)
Similarity:104/229 - (45%) Gaps:19/229 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGTASSIEDRPWQVSLQ-RSGSHFCGGSIISNNIIVTAAHCL--DTPTTVSNLRIRAGSNKR 95
            |::.|....:.:..:|:||| ..|.|.|||.||....::|||||:  ..||   .||:..|:.:.
  Fly    49 RVINGEDVQLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCVYGYNPT---YLRVITGTVEY 110

  Fly    96 TYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAASISGWGK 160
            .....:..|.....|..|||....|||.::||...:.|....:...:.:|..|:|:...::|||.
  Fly   111 EKPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGS 175

  Fly   161 TSTDGPSSATLLFVDTRIVGRSQC-----GSSTYGYGSFIKATMICAAAT-NKDACQGDSGGPLV 219
            |...|.:...|.......|..|.|     ...:.|      ...||...| .:.||.|||||||.
  Fly   176 TELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNG------PCHICTLTTGGQGACHGDSGGPLT 234

  Fly   220 SGGQLVGVVSWGRDCAVANYPGVYANIAELRDWV 253
            ..|.|.|:|:||..||: ..|..:||:....:|:
  Fly   235 HNGVLYGLVNWGYPCAL-GVPDSHANVYYYLEWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 70/227 (31%)
Tryp_SPc 35..253 CDD:238113 69/226 (31%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 70/227 (31%)
Tryp_SPc 50..269 CDD:238113 70/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.