DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG31265

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:259 Identity:94/259 - (36%)
Similarity:129/259 - (49%) Gaps:11/259 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLIATFLALLAL--TNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQR-SGSHFCGG 62
            |.||..:.|.|||:  .|.......:.|..:...|||.||..:.|...|:|||||. .|||.|||
  Fly     1 MKLLRLSLLILLAVKPPNPCESKRIVGPFPAGQSGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGG 65

  Fly    63 SIISNNIIVTAAHCLDT--PTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVV 125
            :|::.|.|:||.||::.  |..|:   :..|:||....|.:...|.|..|..|:.....|||.:|
  Fly    66 AILNENWIITAGHCVENFIPALVN---VITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIALV 127

  Fly   126 RLKTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYG 190
            :|...:||....:.|.:.:.....|....::|||.....|.|...|..:...:|...:| ..|:.
  Fly   128 KLTENITFNELTQPIALPTRPVQLGEEIVLTGWGSDVAYGSSMEDLHKLTVGLVPLDEC-YETFN 191

  Fly   191 YGSFIKATMICA-AATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWV 253
            ..|.:....||. :...:.||.|||||||||.|||||||:|||.|.| ..|.|.||:....||:
  Fly   192 RTSSMGVGHICTFSREGEGACHGDSGGPLVSNGQLVGVVNWGRPCGV-GLPDVQANVYYYLDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 83/222 (37%)
Tryp_SPc 35..253 CDD:238113 82/221 (37%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 83/222 (37%)
Tryp_SPc 39..257 CDD:238113 82/221 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.