DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG17477

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:226 Identity:84/226 - (37%)
Similarity:116/226 - (51%) Gaps:8/226 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 IVGGTASSIEDRPWQVSLQR-SGSHFCGGSIISNNIIVTAAHCL-DTPTTVSNLRIRAGSNKRTY 97
            ||||..::..|.|:|||||. .|||.|||:|||:..|:||.||: ..||  |.|::..|:.:...
  Fly    27 IVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRWIITAGHCVKGYPT--SRLQVATGTIRYAE 89

  Fly    98 GGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITM-ASATPAHGSAASISGWGKT 161
            .|.:....||..|..|:|....||||::.|...:||.:..:|:.: .|..|...|....:|||..
  Fly    90 PGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNALTQAVELPTSPFPRGASELVFTGWGSQ 154

  Fly   162 STDGPSSATLLFVDTRIVGRSQCGSSTYGYGSF-IKATMICA-AATNKDACQGDSGGPLVSGGQL 224
            |..|...:.|..|..:.:....|.|....|... :....||| ...|..||.||||||||..|.|
  Fly   155 SAAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGPCHICAYRQANIGACHGDSGGPLVHQGTL 219

  Fly   225 VGVVSWGRDCAVANYPGVYANIAELRDWVLQ 255
            ||::::...|| ...|.::.||...|||:.|
  Fly   220 VGILNFFVPCA-QGVPDIFMNIMYYRDWMRQ 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 82/222 (37%)
Tryp_SPc 35..253 CDD:238113 82/222 (37%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 84/226 (37%)
Tryp_SPc 27..246 CDD:214473 81/221 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.