DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Try10

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:258 Identity:88/258 - (34%)
Similarity:132/258 - (51%) Gaps:28/258 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLALTNGAV-IPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAA 74
            :|||...|| .|       ::...:||||........|:|||| .||.||||||:|:...:|:||
  Rat     6 ILALVGAAVAFP-------AADDDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINEQWVVSAA 62

  Fly    75 HCLDTPTTV----SNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGS 135
            ||..:...|    .|:.:..|:.:      .|..|.|..|..:...:..|||.:::|.:.:...|
  Rat    63 HCYKSRIQVRLGEHNINVLEGNEQ------FVNAAKIIKHPNFIRKTLNNDIMLIKLSSPVKLNS 121

  Fly   136 TIKAITMASATPAHGSAASISGWGKTSTDGPSSATLL-FVDTRIVGRSQCGSSTYGYGSFIKATM 199
            .:..:.:.|:....|:...|||||.|.:.|.:...|| .:|..::.::.|.:|   |...|...|
  Rat   122 RVATVALPSSCAPAGTQCLISGWGNTLSFGVNEPDLLQCLDAPLLPQADCEAS---YPGKITDNM 183

  Fly   200 ICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQAQKTV 260
            :||.  ...||:||||||||:|..|:|.|:||||..||:.:.||||..:....||:   |.|:
  Rat   184 VCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWI---QDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 79/225 (35%)
Tryp_SPc 35..253 CDD:238113 79/224 (35%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 79/225 (35%)
Tryp_SPc 24..242 CDD:238113 81/230 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.