DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:256 Identity:90/256 - (35%)
Similarity:131/256 - (51%) Gaps:32/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GLEPQTSSLGG-RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNL 86
            |...:|.:.|| ::.||..:...:.|||.|||::..|.||.::|||:.::|||||.         
  Rat   174 GCGRRTITPGGHKVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCF--------- 229

  Fly    87 RIRAGSNKR---TYGGVLVE------VAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITM 142
             :|:.:.|.   ::|.:|.:      |.:|..||.|:..:..|||.||||.:.:.:.:.|:...:
  Rat   230 -VRSANPKDWKVSFGFLLSKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACL 293

  Fly   143 ASATPAH--GSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAA-- 203
            ..||...  .|...::|||...:||.|...|.....:|:....|.|.. .||..|...|:||.  
  Rat   294 PEATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGK-AYGGVITPGMLCAGFL 357

  Fly   204 ATNKDACQGDSGGPLVSGGQ-----LVGVVSWGRDCAVANYPGVYANIAELRDWVLQAQKT 259
            ....|||||||||||||...     |.|:||||.:||:.|.||||..:...|||:  :.||
  Rat   358 EGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWI--SSKT 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 83/236 (35%)
Tryp_SPc 35..253 CDD:238113 83/235 (35%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 83/236 (35%)
Tryp_SPc 187..415 CDD:238113 84/240 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.