DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Klk4

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:230 Identity:70/230 - (30%)
Similarity:107/230 - (46%) Gaps:11/230 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SSLGGRIVGGTASSIEDRPWQVSL-QRSGSHFCGGSIISNNIIVTAAHCLDTPTTVS-NLRIRAG 91
            ||:..||:.|.......:|||.:| ....:.||.|.::....:::||||:....||. .|....|
  Rat    26 SSISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHCIQDSYTVGLGLHNLEG 90

  Fly    92 SNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAASIS 156
            |.:.  |..::|......|..||..|..||:.:::|...:...:||:.|.:||..|..|....:|
  Rat    91 SQEP--GSRMLEAHLSIQHPNYNDPSFANDLMLIKLNESVMESNTIRRIPVASQCPTPGDTCLVS 153

  Fly   157 GWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAA--TNKDACQGDSGGPLV 219
            |||:.. :|...:.|..|:..:.....|   ...|......:|.||..  ..||.|.||||||:|
  Rat   154 GWGRLK-NGKLPSLLQCVNLSVASEETC---RLLYDPVYHLSMFCAGGGPDRKDTCNGDSGGPIV 214

  Fly   220 SGGQLVGVVSWGR-DCAVANYPGVYANIAELRDWV 253
            ....|.|:||.|: :|.....|.||.|:.:..:|:
  Rat   215 CNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 67/223 (30%)
Tryp_SPc 35..253 CDD:238113 66/222 (30%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 65/219 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.