DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG11037

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:243 Identity:77/243 - (31%)
Similarity:116/243 - (47%) Gaps:22/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QTSSLGGRI-----VGG--TASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVS 84
            :|..:||.:     :||  ||...||           ...|||::::.||::|||||.......|
  Fly    59 ETRVIGGHVTTNAKLGGYLTALLYED-----------DFVCGGTLLNENIVLTAAHCFLGRMKAS 112

  Fly    85 NLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAH 149
            ...:.||.:.....|:...|......|.:..:....|:.||.|||.|. ...|..:::.|.:...
  Fly   113 EWIVAAGISNLNQKGIRRHVKDFILSEQFREDDMNMDVAVVLLKTPLK-AKNIGTLSLCSVSLKP 176

  Fly   150 GSAASISGWGKTSTDGPSSATLL-FVDTRIVGRSQCGSSTYGYGSFIKATMICAAAT-NKDACQG 212
            |....:||||.|:..|.....|| .|...|:.:..| .:.|...:.|..:|||||.. .||||..
  Fly   177 GVELVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNC-RAAYQPTAKITDSMICAAVLGRKDACTF 240

  Fly   213 DSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQAQKTV 260
            |||||||...|:.|:||:|..||...|||||.::..::.::.::.|.:
  Fly   241 DSGGPLVFKKQVCGIVSFGIGCASNRYPGVYTDVMYVKPFIEKSIKAL 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 73/227 (32%)
Tryp_SPc 35..253 CDD:238113 73/226 (32%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 75/232 (32%)
Tryp_SPc 62..283 CDD:238113 75/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.