DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG16998

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:250 Identity:77/250 - (30%)
Similarity:115/250 - (46%) Gaps:16/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTA 73
            |||:.|.........|.||.     |||||....|...||..|:...|::.|..::|::..:|||
  Fly     4 LALILLLICGHKTSALSPQE-----RIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTA 63

  Fly    74 AHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIK 138
            .||:..|.:.|   :||||.....||....|.::..|..:|..:..|||.:::|....|.|..|:
  Fly    64 GHCVQYPDSYS---VRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNIQ 125

  Fly   139 AITM----ASATPAHGSAASISGWGK-TSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKAT 198
            .:.:    .:..|   ....::|||. .:||..|...|.....:::.:..|..........|...
  Fly   126 VVKLPLPSLNILP---RTLLVAGWGNPDATDSESEPRLRGTVVKVINQRLCQRLYSHLHRPITDD 187

  Fly   199 MICAAATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWV 253
            |:|||...:|.|.||||.|||..|...|:||:...||..::||||..:|....|:
  Fly   188 MVCAAGAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 69/223 (31%)
Tryp_SPc 35..253 CDD:238113 68/222 (31%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 69/223 (31%)
Tryp_SPc 25..242 CDD:238113 68/222 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.