DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG32271

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:231 Identity:82/231 - (35%)
Similarity:125/231 - (54%) Gaps:5/231 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGS 92
            ::....|||||....|...|:.|:|:..|:..||||:::...:||||||: .....|.:.:.||.
  Fly    18 SNEANSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTAAHCV-KGIGASRILVVAGV 81

  Fly    93 NKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAASISG 157
            .:.|..||...|..:...:|||:.:..:|:.|::||..:: |..:..|.:.:.:...|....:||
  Fly    82 TRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPIS-GPKVSTIELCNTSFKAGDLIKVSG 145

  Fly   158 WGK-TSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAATN-KDACQGDSGGPLVS 220
            ||: |..:...|..:..||..::.|..| .|.|.....|..||.||:... ||||:||||||.|.
  Fly   146 WGQITERNKAVSMQVRSVDVALIPRKAC-MSQYKLRGTITNTMFCASVPGVKDACEGDSGGPAVY 209

  Fly   221 GGQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQA 256
            .|||.|:||||..||..:.||||.|:..:|.::.:|
  Fly   210 QGQLCGIVSWGVGCARKSSPGVYTNVKTVRSFIDKA 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 81/220 (37%)
Tryp_SPc 35..253 CDD:238113 80/219 (37%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 81/220 (37%)
Tryp_SPc 25..244 CDD:238113 80/221 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.