DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG13430

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:233 Identity:92/233 - (39%)
Similarity:133/233 - (57%) Gaps:11/233 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTY 97
            ||||||..:.|...|.|||||....|.|||:|||.|||:|||||:...:......|||||:..|.
  Fly    30 GRIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSDWTK 94

  Fly    98 GGVLVEVAAIKAHEAYNSNSKI-NDIGVVRLKTKLTFGSTIKAITMASATPAHGSAAS--ISGWG 159
            ||..:.|..|..|..::..::: |||.:|:|:..|.:...|:.|::|::.......|.  :||||
  Fly    95 GGSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFVSGWG 159

  Fly   160 KTS-TDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAA--ATNKDACQGDSGGPLVSG 221
            .|| :.......|.:....:..::||..:.:|.|: :..||.||.  |..:|:||||||||||:.
  Fly   160 STSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGT-VTNTMFCAGTQAGGRDSCQGDSGGPLVTS 223

  Fly   222 --G--QLVGVVSWGRDCAVANYPGVYANIAELRDWVLQ 255
              |  :|.|:||||..||.|.:||:|..::...||:.|
  Fly   224 IDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQ 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 89/228 (39%)
Tryp_SPc 35..253 CDD:238113 88/227 (39%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 89/228 (39%)
Tryp_SPc 32..262 CDD:238113 90/231 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443261
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.