DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG32270

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster


Alignment Length:234 Identity:87/234 - (37%)
Similarity:131/234 - (55%) Gaps:26/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAG------- 91
            |||||..|.:..:|..|:::|.|:..||||:::...::||||||:.... |:..:|.|       
  Fly    30 RIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNP-SDFVVRGGVTYLSDM 93

  Fly    92 SNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAASIS 156
            .|.|....:|:.       .||:..:..:|:.:::||..|. .|..|.|::|..:|..||...:|
  Fly    94 RNSRYVRKILMP-------SAYSRTTLDHDVALLQLKQPLQ-ASIAKPISLAVRSPRPGSFVRVS 150

  Fly   157 GWGKT---STDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAATN-KDACQGDSGGP 217
            |||.|   ||..|:.  |..|..:::.:.:|.....||.: |.::|.||:... ||||.||||||
  Fly   151 GWGLTDSSSTSLPNQ--LQSVHVQVMPQRECRDLYRGYRN-ITSSMFCASVPGLKDACAGDSGGP 212

  Fly   218 LV-SGGQLVGVVSWGR--DCAVANYPGVYANIAELRDWV 253
            :| |.|.|||||||||  .||..:.||||::::.|.||:
  Fly   213 VVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 86/232 (37%)
Tryp_SPc 35..253 CDD:238113 85/231 (37%)
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 86/232 (37%)
Tryp_SPc 31..254 CDD:238113 86/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.