DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG9897

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:276 Identity:76/276 - (27%)
Similarity:119/276 - (43%) Gaps:49/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALLALTNGAVIP-IGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVT 72
            ||.|.|.....:| :.|..|      ||:.|...:|:|.||..|:..:....|||:|||.|.|:|
  Fly     2 LAPLILLQIVALPWLALGDQ------RIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYILT 60

  Fly    73 AAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTI 137
            ||.|:| ..:..::::|.|::.....|.:..:..:|.|..|:|....|::.:::....|.....|
  Fly    61 AAKCVD-GYSARSIQVRLGTSSCGTSGSIAGICKVKVHSQYSSWRFDNNLALLKTCELLNTTDEI 124

  Fly   138 KAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVD--------------------------T 176
            |.|..|...|...|.|:::|.|..|.:        |:|                          .
  Fly   125 KPIERADKVPDDNSRANVTGCGGRSGN--------FLDLILDLRISSGIEEKCFQLPVQLHGTQV 181

  Fly   177 RIVGRSQCGSS----TYGYGSFIKATMICAAATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVA 237
            ||:.:.||.:.    .:.....|....||..:..|.||..|.|.|||...:|||::| ...|::.
  Fly   182 RILSQKQCAADWKVIPFYLLKGISDLTICTKSPGKGACSTDRGSPLVIDNKLVGILS-RAGCSIK 245

  Fly   238 NYPGVYANIAELRDWV 253
              |.|||||....:|:
  Fly   246 --PDVYANILGHTNWL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 68/248 (27%)
Tryp_SPc 35..253 CDD:238113 67/247 (27%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 68/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.