DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and zetaTry

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster


Alignment Length:273 Identity:118/273 - (43%)
Similarity:151/273 - (55%) Gaps:31/273 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LIATFLALLALTNGAVIPIGLE--PQTSSLGGRIVGGTASSIEDRPWQVSLQRSG--------SH 58
            |:|..::|:|||.|  :|: ||  .:.|...||||||.|:.|...|:|:||:..|        .|
  Fly     9 LLAFLVSLVALTQG--LPL-LEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRH 70

  Fly    59 FCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGSNKRT-YGGVLVEVAAIKAHEAYNSNSKI-ND 121
            .|||||.:...|||||||: ..|..|..::.||:|.:| ..||:..|..|..||.|.|.:.. ||
  Fly    71 RCGGSIFNETTIVTAAHCV-IGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNND 134

  Fly   122 IGVVRLKTKLTFGS-TIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQC- 184
            |.::.:...|...: |||||.:|...|..|:.:.:||||.||..|.||..||.||..||....| 
  Fly   135 IAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYSSNQLLAVDVPIVSNELCD 199

  Fly   185 ------GSSTYGYGSFIKATMICA---AATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYP 240
                  |..||.    |.:.|:||   .....|||||||||||....:|.||||||..||:.|||
  Fly   200 QDYEDFGDETYR----ITSAMLCAGKRGVGGADACQGDSGGPLAVRDELYGVVSWGNSCALPNYP 260

  Fly   241 GVYANIAELRDWV 253
            |||||:|.||.|:
  Fly   261 GVYANVAYLRPWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 105/239 (44%)
Tryp_SPc 35..253 CDD:238113 104/238 (44%)
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 105/239 (44%)
Tryp_SPc 39..276 CDD:238113 105/240 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443244
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.