DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Phae2

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:271 Identity:80/271 - (29%)
Similarity:128/271 - (47%) Gaps:30/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IATFLAL-LALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNN 68
            :||.|.| :.::.|:.:.:. :|:     ||:|||.|::....|:.||:|..|:|:|..:||::|
  Fly     7 LATILLLAVCVSQGSGLALD-QPE-----GRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSN 65

  Fly    69 IIVTAAHCLDTPTTVSNLRIRAGS----------NKRTYGGVLVEVAAIKAHEAYNSNSKINDIG 123
            .:|||||||.....|....:.|||          .||       ::.....::.|...:...|||
  Fly    66 WLVTAAHCLANRNQVLGSTLVAGSIAVAGTASTTQKR-------QITHYVINDLYTGGTVPYDIG 123

  Fly   124 VVRLKTKLTFGSTIKAITMASATPAHGSAASISGWGKTS-TDGPSSATLL--FVDTRIVGRSQCG 185
            ::...|..|:.:.:..:.:.|:.......|.:.|||.|| |:.||....|  ..:..|:....|.
  Fly   124 LIYTPTAFTWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISLDSCA 188

  Fly   186 SSTYGYGSFIKATMICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGR-DCAVANYPGVYANIA 247
            ::....|..:..|.:|..  ......|..|||||||.|..|:|:||||: .|...|.|.||..::
  Fly   189 AALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNSPSVYVQVS 253

  Fly   248 ELRDWVLQAQK 258
            ....|:...||
  Fly   254 SFITWIAANQK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 70/234 (30%)
Tryp_SPc 35..253 CDD:238113 69/233 (30%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 70/234 (30%)
Tryp_SPc 32..262 CDD:238113 70/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.