DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and PRSS48

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:268 Identity:90/268 - (33%)
Similarity:129/268 - (48%) Gaps:40/268 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTA 73
            |:.|:|..|       :|..||   |:|||..::....||||||....:..||||::|..:|:||
Human    35 LSSLSLVCG-------QPVYSS---RVVGGQDAAAGRWPWQVSLHFDHNFICGGSLVSERLILTA 89

  Fly    74 AHCLDTPTTVSNLRIRAG------SNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLT 132
            |||:....|..:..:..|      |.||    |...|:.|..|..|...:.  |:.:::|.:::|
Human    90 AHCIQPTWTTFSYTVWLGSITVGDSRKR----VKYYVSKIVIHPKYQDTTA--DVALLKLSSQVT 148

  Fly   133 FGSTIKAITMASATP--AHGSAASISGWGKT--STDGPSSATLLFVDTRIVGRSQCGSSTYGYGS 193
            |.|.|..|.:.|.|.  |......::||||.  |:|....:.|...:..|:.|..|.......|.
Human   149 FTSAILPICLPSVTKQLAIPPFCWVTGWGKVKESSDRDYHSALQEAEVPIIDRQACEQLYNPIGI 213

  Fly   194 F-------IKATMICAAATN--KDACQGDSGGPL---VSGGQL-VGVVSWGRDCAVANYPGVYAN 245
            |       ||...|||..|.  ||:|:|||||||   :.|..: .||||||.:|. .:.||||.|
Human   214 FLPALEPVIKEDKICAGDTQNMKDSCKGDSGGPLSCHIDGVWIQTGVVSWGLECG-KSLPGVYTN 277

  Fly   246 IAELRDWV 253
            :...:.|:
Human   278 VIYYQKWI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 82/241 (34%)
Tryp_SPc 35..253 CDD:238113 81/240 (34%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 82/241 (34%)
Tryp_SPc 51..288 CDD:238113 82/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.