DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and PRSS53

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:325 Identity:78/325 - (24%)
Similarity:130/325 - (40%) Gaps:92/325 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLALTNGAVIPIGLEPQTSSLG-----------GRIVGGTASSIEDRPWQVSLQRSGSHFCGGSI 64
            :|.:....|:..||:....:.|           |..|.|      :.|||.|::|.|:|.|.||:
Human     8 VLLIAGATVLMEGLQAAQRACGQRGPGPPKPQEGNTVPG------EWPWQASVRRQGAHICSGSL 66

  Fly    65 ISNNIIVTAAHCLD--TPTTVSNLRIRAGSNKR---TYGGVLVEVAAIKAHEAYNSNSKINDIGV 124
            :::..::|||||.:  ..|.:::..:..||.:|   :.|...|.|||::...|||..|:.:|:.:
Human    67 VADTWVLTAAHCFEKAAATELNSWSVVLGSLQREGLSPGAEEVGVAALQLPRAYNHYSQGSDLAL 131

  Fly   125 VRLKTKLTFGSTIKAITMASATPAH----GSAASISGWGKTSTDG-------------------- 165
            ::|....|.      ..:....|||    |::...:||.:.::||                    
Human   132 LQLAHPTTH------TPLCLPQPAHRFPFGASCWATGWDQDTSDGKCWPRLKLGEALCLPSVTVS 190

  Fly   166 -------------------------PSSATLLFVDTRIVGRSQCGSSTYG------YGSFIKATM 199
                                     |:..||..:..|::.|..| :..|.      ..:..:..|
Human   191 APNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPTC-NCIYNQLHQRHLSNPARPGM 254

  Fly   200 ICAAATN--KDACQGDSGGP---LVSGGQLV--GVVSWGRDCAVANYPGVYANIAELRDWVLQAQ 257
            :|.....  :..||||||||   |...|..|  |::|:...||..:.|.:..|.|....| |||:
Human   255 LCGGPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISFASSCAQEDAPVLLTNTAAHSSW-LQAR 318

  Fly   258  257
            Human   319  318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 68/285 (24%)
Tryp_SPc 35..253 CDD:238113 68/284 (24%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 69/287 (24%)
Tryp_SPc 43..314 CDD:214473 68/283 (24%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149442
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.