DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Ser6

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:262 Identity:93/262 - (35%)
Similarity:135/262 - (51%) Gaps:23/262 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSII 65
            :::|:.:||..|      |:|:...|  ..|.||:|||..:.....|.||||:.:|||.|||||:
  Fly     6 VAILLCSFLLFL------VLPVQSAP--GKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSIL 62

  Fly    66 SNNIIVTAAHCLD--------TPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDI 122
            :...|:|||||:.        ||.......||||||.|..|||||:||.:..||.|  .:.:||:
  Fly    63 TRTYILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY--GNFLNDV 125

  Fly   123 GVVRLKTKLTFGSTIKAITMASA-TPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGS 186
            .::||::.|...::|:.|.:.:. |||..... |||||:....|.....|.:...:.:.|.|| .
  Fly   126 ALLRLESPLILSASIQPIDLPTVDTPADVDVV-ISGWGRIKHQGDLPRYLQYNTLKSITRQQC-E 188

  Fly   187 STYGYGSFIKATMICAAATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRD 251
            ....:|  .:..:......:..||.||||||.|...|||||..:..|...:.||..||.:...:|
  Fly   189 ELIDFG--FEGELCLLHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCGSTYPDGYARVFYFKD 251

  Fly   252 WV 253
            |:
  Fly   252 WI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 83/227 (37%)
Tryp_SPc 35..253 CDD:238113 82/226 (36%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 83/227 (37%)
Tryp_SPc 32..256 CDD:238113 83/228 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.