DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Prss53

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:270 Identity:78/270 - (28%)
Similarity:133/270 - (49%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GAVIPI-GLEPQTSSLGGR-------IVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTA 73
            |||:.| ||:....:.|.|       ..|.|...  :.|||.|::|.|.|.|.||::::..::||
Mouse    13 GAVVVIEGLQAAQRACGQRGPGPPEPQEGNTLPG--EWPWQASVRRQGVHICSGSLVADTWVLTA 75

  Fly    74 AHCLDTPTT--VSNLRIRAGSNK---RTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTF 133
            |||.:...|  :|:..:..||.|   ::.|...|.|||::..:|||..|:.:|:.:::|.     
Mouse    76 AHCFEKMATAELSSWSVVLGSLKQEGQSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLT----- 135

  Fly   134 GSTIKAITMASATPAH----GSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYG---- 190
            ..|::. |:....|.:    |::...:||.:.::|  .|.||..:..|::.|..| :..|.    
Mouse   136 HPTVQT-TLCLPQPTYHFPFGASCWATGWDQNTSD--VSRTLRNLRLRLISRPTC-NCLYNRLHQ 196

  Fly   191 --YGSFIKATMICAAAT--NKDACQGDSGGPLV----SGGQL-VGVVSWGRDCAVANYPGVYANI 246
              ..:..:..|:|..|.  .:..||||||||::    .|..: ||::|:...||..:.|.:..::
Mouse   197 RLLSNPARPGMLCGGAQPGEQGPCQGDSGGPVMCREPDGHWVQVGIISFTSKCAQEDTPVLLTDM 261

  Fly   247 AELRDWVLQA 256
            |....| |||
Mouse   262 AVHSSW-LQA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 67/247 (27%)
Tryp_SPc 35..253 CDD:238113 66/239 (28%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 4/18 (22%)
Tryp_SPc 45..271 CDD:238113 68/238 (29%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.