DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Prss34

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:278 Identity:82/278 - (29%)
Similarity:127/278 - (45%) Gaps:28/278 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQ------RSGSHF 59
            :.:|...||:|..|.|...:.:.|......:|  ||||...|....||||||:      ....|.
Mouse     3 LGMLWLLFLSLPCLGNTMPLTLDLGSGQGLVG--IVGGCPVSASRFPWQVSLRLYDMEHSRWEHE 65

  Fly    60 CGGSIISNNIIVTAAHCLDTPTTVS--NLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKIN-- 120
            ||||:|....::|||||: .|..|.  .:|::.|..:......|::|..|..|..::......  
Mouse    66 CGGSLIHPQWVLTAAHCV-RPKEVEAYGVRVQVGQLRLYENDQLMKVVKIIRHPKFSEKLSARGG 129

  Fly   121 -DIGVVRLKTKLTFGSTIKAITMASATPAHGSAAS--ISGWG--KTSTDGPSSATLLFVDTRIVG 180
             ||.:::|.|::.....:..:::.:|:....|..:  ::|||  :.....|....|..|...||.
Mouse   130 ADIALLKLDTRVVLSEHVYPVSLPAASLRISSKKTCWVAGWGVIENYMPLPPPYHLREVAVPIVE 194

  Fly   181 RSQC------GSSTYGYGSFIKATMICAAATNKDACQGDSGGPLVSGGQL----VGVVSWGRDCA 235
            .:.|      .||:......||..|:||....:|:|:.|||||||.....    |||||||..|.
Mouse   195 NNDCEQKYQTNSSSDSTTRIIKDDMLCAGKEGRDSCKADSGGPLVCRWNCSWVQVGVVSWGIGCG 259

  Fly   236 VANYPGVYANIAELRDWV 253
            :.::||||..:.....|:
Mouse   260 LPDFPGVYTRVMSYVSWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 73/243 (30%)
Tryp_SPc 35..253 CDD:238113 73/242 (30%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 74/244 (30%)
Tryp_SPc 35..277 CDD:214473 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.