DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG9673

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001285346.1 Gene:CG9673 / 32649 FlyBaseID:FBgn0030775 Length:261 Species:Drosophila melanogaster


Alignment Length:262 Identity:74/262 - (28%)
Similarity:126/262 - (48%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTA 73
            |.|..|..|.::.....||     |||:||...:..:.||..|::.:.:|.|.|:|||.|.|:||
  Fly     8 LGLGLLIFGLILSAEASPQ-----GRILGGEDVAQGEYPWSASVRYNKAHVCSGAIISTNHILTA 67

  Fly    74 AHCLD----TPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFG 134
            |||:.    ||...|.|.:|.|:..:..||.:|.|.::..|.:|  .:.::||.::.|...|.|.
  Fly    68 AHCVSSVGITPVDASTLAVRLGTINQYAGGSIVNVKSVIIHPSY--GNFLHDIAILELDETLVFS 130

  Fly   135 STIKAITMASATP----------AHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQC-GSST 188
            ..|:.|.:...|.          .:|:...::|||:.| ||.:|......:...:.||.| ..:.
  Fly   131 DRIQDIALPPTTDEETEDVDAELPNGTPVYVAGWGELS-DGTASYKQQKANYNTLSRSLCEWEAG 194

  Fly   189 YGYGSFIKATMIC-AAATNKDACQGDSGGPLVSGGQLV-GVVSWGRDCAVANYPGVYANIAELRD 251
            |||.|     ::| :.|..:..|:||:|..::...::: |:.|:......:.||.|...::....
  Fly   195 YGYES-----VVCLSRAEGEGICRGDAGAAVIDDDKVLRGLTSFNFGPCGSKYPDVATRVSYYLT 254

  Fly   252 WV 253
            |:
  Fly   255 WI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 66/235 (28%)
Tryp_SPc 35..253 CDD:238113 65/234 (28%)
CG9673NP_001285346.1 Tryp_SPc 28..256 CDD:214473 66/235 (28%)
Tryp_SPc 29..259 CDD:238113 66/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.