DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG31681

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:268 Identity:104/268 - (38%)
Similarity:143/268 - (53%) Gaps:36/268 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSII 65
            :.||::..:::..|...|.|| |.|.       |||||:...||..|||||:|.:..|.|||.|.
  Fly     3 LRLLLSILVSIAGLACAARIP-GPEE-------RIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIY 59

  Fly    66 SNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAH-----EAYNSNSKINDIGVV 125
            |:..|:||||||.. .||::|.:||||:..:.||.:::|....||     :.||.    .||.|:
  Fly    60 SDRAILTAAHCLSN-VTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNP----YDIAVL 119

  Fly   126 RLKTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLF-----VDTRIVGRSQCG 185
            .|:..|..|.|:|.|.:|..||..|:....||||.|.    .:::.|:     |...|:.|:.| 
  Fly   120 ILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTR----ENSSFLWPILQGVHVAILNRTDC- 179

  Fly   186 SSTYGYGSFIKATMICAAATNKDACQGDSGGPLV---SGG--QLVGVVSWGRDCAVANYPGVYAN 245
            ...|.:.: |...||||.....|.|||||||||:   .||  ||:|:||||..|  ...||||.:
  Fly   180 LKAYKHVN-ITIDMICADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGC--GTNPGVYED 241

  Fly   246 IAELRDWV 253
            ||...:|:
  Fly   242 IAFFHNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 95/233 (41%)
Tryp_SPc 35..253 CDD:238113 94/232 (41%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 95/233 (41%)
Tryp_SPc 29..250 CDD:238113 95/234 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443203
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.