DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG31267

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:242 Identity:77/242 - (31%)
Similarity:112/242 - (46%) Gaps:30/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SSLGGRIVGGTASSIEDRPWQVSLQRS-GSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGS 92
            :....|||||..|.:...|:.||||.: |:|||.||||.:..::|||.||            ||.
  Fly    39 NKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHDQWVITAASCL------------AGL 91

  Fly    93 NKR-------TYG-----GVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASA 145
            .|.       ||.     |.:..|..|..|..::|....|||.:::......:....:.||:|..
  Fly    92 RKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVTQNITIAPL 156

  Fly   146 TP-AHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAA-TNKD 208
            .. ..|...::.|:|.|...|..|..|..:|...|...:| ::|||....:....:||.. ....
  Fly   157 EDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKC-NATYGGTPDLDVGHLCAVGKVGAG 220

  Fly   209 ACQGDSGGPLV-SGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVL 254
            ||.||:|||:| |.|:||||.:||..|.. .:|.|:|.|:....|::
  Fly   221 ACHGDTGGPIVDSRGRLVGVGNWGVPCGY-GFPDVFARISFYYSWII 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 76/234 (32%)
Tryp_SPc 35..253 CDD:238113 75/233 (32%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 76/234 (32%)
Tryp_SPc 45..268 CDD:238113 76/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.