DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG32834

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:270 Identity:83/270 - (30%)
Similarity:126/270 - (46%) Gaps:33/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLIATFLALLALTNGAVIPIGLEPQTSSLG--GRIVGGTASSIEDRPWQVSLQRSGSHFCGGSII 65
            ::.:.||.|||..        |.|....|.  .||:||....|||.|:|..:...|:..|.|:||
  Fly     1 MIWSVFLFLLAAL--------LRPVRGDLDAQSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAII 57

  Fly    66 SNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGV--LVEVAAIKAHEAYNSNSKINDIGVVRLK 128
            :::.|:|||.|:.   :..::.:|.|::.|.|.|.  |:||..|..|..||.....|::.:::|.
  Fly    58 TSDTIITAASCVQ---SYGSIEVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLC 119

  Fly   129 TKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDG----------PSSATLLFVDTRIVGRSQ 183
            ..|.....|:.|::|...|..||..::||||.||..|          |....:.:|.  :..|.|
  Fly   120 DPLKTSEAIQPISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVS--VYNREQ 182

  Fly   184 CGSST-YGYGSFIKATMICAAATNKDA--CQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYAN 245
            |.:.. ..:|.:..........|:..|  |..|:|.|||..|||||::|.| .|...  |.||||
  Fly   183 CAADRGVWFGLWDNGISYLTLCTHNGAGGCSYDTGAPLVIDGQLVGILSEG-GCTTK--PDVYAN 244

  Fly   246 IAELRDWVLQ 255
            :.....|:.:
  Fly   245 VPWFTGWIAE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 74/233 (32%)
Tryp_SPc 35..253 CDD:238113 73/232 (31%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 74/233 (32%)
Tryp_SPc 27..255 CDD:238113 74/236 (31%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.