DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG32523

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_728401.1 Gene:CG32523 / 318071 FlyBaseID:FBgn0052523 Length:262 Species:Drosophila melanogaster


Alignment Length:255 Identity:95/255 - (37%)
Similarity:135/255 - (52%) Gaps:15/255 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLALTNGAVIPIGLE----PQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIV 71
            ||.|..|..:.:|.:    ...|::..|||||..:.....|.|:||:..|.|:|||.|||...::
  Fly     9 LLLLLCGVQVILGQDVAQNQSESAIEPRIVGGIKAKQGQFPHQISLRLRGEHYCGGVIISATHVI 73

  Fly    72 TAAHCLDTPTTV--SNL-RIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTF 133
            ||.||:.....|  ::| .|:|||...:..||.:.||.:..|..|.:... ||:.|:||::.|||
  Fly    74 TAGHCVKHGNDVVPADLWSIQAGSLLLSSDGVRIPVAEVIMHPNYATGGH-NDLAVLRLQSPLTF 137

  Fly   134 GSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKAT 198
            .:.|.||.:|:..|.:..|..|||||..:..||.|.:||||....:.|..|....|   |.:..|
  Fly   138 DANIAAIQLATEDPPNCVAVDISGWGNIAEKGPLSDSLLFVQVTSISRGACRWMFY---SRLPET 199

  Fly   199 MICAA-ATNKDACQGDSGGPLVSGGQLVGVVS--WGRDCAVANYPGVYANIAELRDWVLQ 255
            |||.. :.|..||.||||||...||::||:.|  .|..|..| .|..|..|:::|.|:.:
  Fly   200 MICLLHSKNSGACYGDSGGPATYGGKVVGLASLLLGGGCGRA-APDGYLRISKVRAWIAE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 88/224 (39%)
Tryp_SPc 35..253 CDD:238113 87/223 (39%)
CG32523NP_728401.1 Tryp_SPc 36..256 CDD:214473 88/224 (39%)
Tryp_SPc 37..219 CDD:238113 73/185 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.