DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Klk15

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_777354.1 Gene:Klk15 / 317652 MGIID:2447533 Length:254 Species:Mus musculus


Alignment Length:270 Identity:79/270 - (29%)
Similarity:118/270 - (43%) Gaps:40/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSII 65
            |.||:|..|.:.|..:               |.:::.|.......:||||:|...|...||..:|
Mouse     1 MWLLLAFVLLVSAAQD---------------GDKVLEGEECVPHSQPWQVALFERGRFNCGAFLI 50

  Fly    66 SNNIIVTAAHCLDTPTTVSNLRIRAGS-NKRTYGG--VLVEVAAIKAHEAYNSNSKINDIGVVRL 127
            |...::|||||     ....:|:|.|. |.|.:.|  .|..|:.|..|..|.:.:..:||.::||
Mouse    51 SPRWVLTAAHC-----QTRFMRVRLGEHNLRKFDGPEQLRSVSRIIPHPGYEARTHRHDIMLLRL 110

  Fly   128 KTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSA-----------TLLFVDTRIVGR 181
            .......:.::.:.:....|..|....:||||..|.:.|.:.           ||...:..|:..
Mouse   111 FKPARLTAYVRPVALPRRCPLIGEDCVVSGWGLLSDNNPGATGSQKSHVRLPDTLHCANISIISE 175

  Fly   182 SQCGSSTYGYGSFIKATMICAAAT--NKDACQGDSGGPLVSGGQLVGVVSWGR-DCAVANYPGVY 243
            :.|...   |...:..||:||...  ..|:|:||||||||.||.|.|:||||. .|.....||||
Mouse   176 ASCNKD---YPGRVLPTMVCAGVEGGGTDSCEGDSGGPLVCGGALQGIVSWGDVPCDTTTKPGVY 237

  Fly   244 ANIAELRDWV 253
            ..:....:|:
Mouse   238 TKVCSYLEWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 71/235 (30%)
Tryp_SPc 35..253 CDD:238113 71/234 (30%)
Klk15NP_777354.1 Tryp_SPc 23..247 CDD:238113 71/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.