DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG6041

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:282 Identity:93/282 - (32%)
Similarity:135/282 - (47%) Gaps:37/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLIATFLALLALTNGAVIPIGLEPQTSSLGG----RIVGGTASSIEDRPWQVSLQRSGS------ 57
            |.||.||.  ||.:|       |..:|...|    :||||..:|||...:|||::.:.:      
  Fly     8 LAIALFLG--ALASG-------ESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYG 63

  Fly    58 --HFCGGSIISNNIIVTAAHCL-----DTPTTVSNLRIRAGS---NKRTYGGVLVEVAAIKAHEA 112
              |.|||.:||..::.|||||.     ....|.....:..||   ...|...::..:..:..||.
  Fly    64 SGHLCGGVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHEN 128

  Fly   113 YNSNSKINDIGVVRLKTKLTFG-STIKAITMASATPAHGSAASISGWGKTSTDGP-SSATLLFVD 175
            ||.::..|||.::.:...:.:. .|:.|:.:.|...|..:...|||||....:|. ||.||....
  Fly   129 YNPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAAT 193

  Fly   176 TRIVGRSQCGSSTYGYGSFIKATMICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVAN 238
            ..||..:.|..|   |.| |..:.:||.  :...||||||||||:...|.|.|:||:|..||...
  Fly   194 VPIVSYTTCRIS---YNS-IPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPG 254

  Fly   239 YPGVYANIAELRDWVLQAQKTV 260
            |||||.|::...||::|...::
  Fly   255 YPGVYTNVSYYYDWIVQKNSSL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 80/238 (34%)
Tryp_SPc 35..253 CDD:238113 80/237 (34%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 80/238 (34%)
Tryp_SPc 35..272 CDD:238113 81/240 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.