DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Prtn3

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:262 Identity:71/262 - (27%)
Similarity:111/262 - (42%) Gaps:49/262 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 PIGLEPQTSSL------------GGRIVGGTASSIEDRPWQVSLQRS---GSHFCGGSIISNNII 70
            ||...|:...|            ..:||||..:....||:..|||.|   |||||||::|....:
  Rat   172 PIPRSPRLPCLRLAGVRFHGAVQASKIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHPRFV 236

  Fly    71 VTAAHCL-----DTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTK 130
            :||||||     ...|.|........|........:.:|    ....||....:||:.:::|...
  Rat   237 LTAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTITQV----FENNYNPEETLNDVLLLQLNRP 297

  Fly   131 LTFGSTIKAITMAS-----ATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYG 190
            .:.|   |.:.:||     .:.:.|:.....|||:..|..|:...|..::..:|           
  Rat   298 ASLG---KQVAVASLPQQDQSLSQGTQCLAMGWGRLGTRAPTPRVLHELNVTVV----------- 348

  Fly   191 YGSFI-KATMICAAATNKDA--CQGDSGGPLVSGGQLVGVVSWG-RDCAVANYPGVYANIAELRD 251
              :|: :...:|.....:.|  |.|||||||:..|.|.||.|:. |:||...:|..:|.::...:
  Rat   349 --TFLCREHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVN 411

  Fly   252 WV 253
            |:
  Rat   412 WI 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 66/235 (28%)
Tryp_SPc 35..253 CDD:238113 66/234 (28%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 67/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.