DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and LOC312273

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:256 Identity:84/256 - (32%)
Similarity:121/256 - (47%) Gaps:22/256 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNI 69
            |..|..||...  |..|      |.....|||||........|:|||| .:|||.||||:|::..
  Rat     3 ICIFFTLLGTV--AAFP------TEDNDDRIVGGYTCQEHSVPYQVSL-NAGSHICGGSLITDQW 58

  Fly    70 IVTAAHCLDTPTTVSNLRIRAGS-NKRTYGGV--LVEVAAIKAHEAYNSNSKINDIGVVRLKTKL 131
            :::||||..     ..|::|.|. |.....|.  .::.|.:..|..|:..:..|||.:::||:..
  Rat    59 VLSAAHCYH-----PQLQVRLGEHNIYEIEGAEQFIDAAKMILHPDYDKWTVDNDIMLIKLKSPA 118

  Fly   132 TFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIK 196
            |..|.:..|.:....|..|:...:||||.......|.:.|..:|..::..|.|..:   |...|.
  Rat   119 TLNSKVSTIPLPQYCPTAGTECLVSGWGVLKFGFESPSVLQCLDAPVLSDSVCHKA---YPRQIT 180

  Fly   197 ATMICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQ 255
            ..|.|..  ...||:||.|||||:|..|::.|:||||..||:...||||..:....:|:.|
  Rat   181 NNMFCLGFLEGGKDSCQYDSGGPVVCNGEVQGIVSWGDGCALEGKPGVYTKVCNYLNWIHQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 75/223 (34%)
Tryp_SPc 35..253 CDD:238113 74/222 (33%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 76/226 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.