DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG14780

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:248 Identity:76/248 - (30%)
Similarity:119/248 - (47%) Gaps:37/248 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGTASSIEDRPWQVSLQ------RSGS-HFCGGSIISNNIIVTAAHCLDTPTTVSNLRIR-- 89
            ||:.|:.:..::....||::      ..|| |.|||::|:...::||||||     .:|.|.|  
  Fly    32 RIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALIAPRKVLTAAHCL-----YNNQRKRFR 91

  Fly    90 --------AGSNKR---TYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGS------TI 137
                    .|:..|   ..|.::.:|:::.....::.:|..:|:|::.|:|.|....      |:
  Fly    92 RASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRDDVGILFLRTGLPMSPGGGVHLTV 156

  Fly   138 KAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICA 202
            ..|.:|......|....::|||:|.....|: .||..:...:....|...   |.|.:...|:||
  Fly   157 APIQLAGQITPPGKLCQVAGWGRTEQSSLSN-ILLTANVSTIRHQTCRMI---YRSGLLPGMMCA 217

  Fly   203 AAT--NKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWV 253
            ...  ..|:||||||||||..|:||||||||..||....||||.::...|.|:
  Fly   218 GRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 75/246 (30%)
Tryp_SPc 35..253 CDD:238113 74/245 (30%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 75/246 (30%)
Tryp_SPc 33..271 CDD:238113 75/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.