DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Klk12

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:236 Identity:71/236 - (30%)
Similarity:102/236 - (43%) Gaps:32/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHC------------LDTPTTVSNL 86
            :|..|.......:||||.|.......|||.::....::|||||            |........|
  Rat    21 KIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKWVLTAAHCSGKYMVRLGEHSLSKLDLTEQL 85

  Fly    87 RIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGS 151
            |:...|           :.....|.||.::.  :|:.::||...::....::.:.:.|:....|:
  Rat    86 RLTTFS-----------ITHPSYHGAYQNHE--HDLRLLRLNRPISLTYAVRPVALPSSCAPTGA 137

  Fly   152 AASISGWGKTSTD-GPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAA-TNKDACQGDS 214
            ...|||||.|:.. .|....|..:|..||....|.:...|.   :...|:||.. ..||||||||
  Rat   138 KCHISGWGTTNKPWDPFPDRLQCLDLSIVSNETCRAVFPGR---VTENMLCAGGEAGKDACQGDS 199

  Fly   215 GGPLVSGGQLVGVVSWGR--DCAVANYPGVYANIAELRDWV 253
            |||||.||.|.|:||||.  .|.....||||..:.:..||:
  Rat   200 GGPLVCGGVLQGLVSWGSVGPCGQKGIPGVYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 70/234 (30%)
Tryp_SPc 35..253 CDD:238113 70/233 (30%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 70/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.