DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Klk1c3

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:269 Identity:80/269 - (29%)
Similarity:114/269 - (42%) Gaps:37/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLAL-LALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIV 71
            ||.| |||:.|   .|...|...|   |:|||.......:||||::  .....|||.:|..:.::
  Rat     3 FLILFLALSLG---QIDAAPPGQS---RVVGGFKCEKNSQPWQVAV--INEDLCGGVLIDPSWVI 59

  Fly    72 TAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAY------NSNSK----INDIGVVR 126
            |||||..     .|..:..|.|..:.......|:....|..|      |...|    .||:.::.
  Rat    60 TAAHCYS-----DNYHVLLGQNNLSEDVQHRLVSQSFRHPDYKPFLMRNHTRKPKDYSNDLMLLH 119

  Fly   127 LKTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSS----ATLLFVDTRIVGRSQCGSS 187
            |.........:|.|.:.:..|..||...:||||.|:   ||.    ..|..|:..::...:|   
  Rat   120 LSEPADITDGVKVIDLPTKEPKVGSTCLVSGWGSTN---PSEWEFPDDLQCVNIHLLSNEKC--- 178

  Fly   188 TYGYGSFIKATMICAAAT--NKDACQGDSGGPLVSGGQLVGVVSWGR-DCAVANYPGVYANIAEL 249
            ...|...:...|:||...  .||.|:|||||||:..|.|.|:.|||. .|...|.||:|..:.:.
  Rat   179 IKAYKEKVTDLMLCAGELEGGKDTCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTKLIKF 243

  Fly   250 RDWVLQAQK 258
            ..|:.:..|
  Rat   244 TSWIKEVMK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 68/235 (29%)
Tryp_SPc 35..253 CDD:238113 67/234 (29%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 68/235 (29%)
Tryp_SPc 25..250 CDD:238113 68/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.