DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Klk10

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:247 Identity:67/247 - (27%)
Similarity:103/247 - (41%) Gaps:55/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHC-LDTPTTVSNLRIRAGSNKRTYGGVL 101
            ||......:||||||..:....|.|.::..|.::||||| .:.|     ||.|.|.:        
  Rat    50 GTLCPSVSQPWQVSLFHNLQFQCAGVLVDQNWVLTAAHCWRNKP-----LRARVGDD-------- 101

  Fly   102 VEVAAIKAHEAYNSNSKI-------------------NDIGVVRLKTKLTFGSTIKAITMASATP 147
             .:...::.:..::||.:                   :|:.:::|.:.:...|.:..:.:.....
  Rat   102 -HLLLFQSEQLRSTNSPVFHPKYQPCSGPVLPLRSDEHDLMMLKLSSPVVLTSKVHPVQLPFQCA 165

  Fly   148 AHGSAASISGWGKTSTD--------GPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAA 204
            .......:||||.|:..        ..|..|||       .:.||  .|: |...|...||||..
  Rat   166 QPRQECQVSGWGTTANRRVKYNRSLSCSRVTLL-------SQKQC--ETF-YPGVITNNMICAGM 220

  Fly   205 -TNKDACQGDSGGPLVSGGQLVGVVSWG-RDC-AVANYPGVYANIAELRDWV 253
             .::|:||.|||||||....|.|::||. ..| |...||.|||.|....:|:
  Rat   221 DRDQDSCQSDSGGPLVCDNTLHGILSWSIYPCGAATQYPAVYAKICNYTNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 66/245 (27%)
Tryp_SPc 35..253 CDD:238113 66/245 (27%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 66/245 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.