DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Klk11

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:275 Identity:87/275 - (31%)
Similarity:134/275 - (48%) Gaps:44/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SLLIATFLALLALTNGAVIPIGLEPQTSSLGG--RIVGGTASSIEDRPWQVSLQRSGSHFCGGSI 64
            :::|..|:| |||..|.|            ||  ||:.|.......:||||:|.:.....||.::
  Rat    29 AMMILRFIA-LALVTGHV------------GGETRIIKGYECRPHSQPWQVALFQKTRLLCGATL 80

  Fly    65 ISNNIIVTAAHCLDTPTTV----SNLRIRAGSNKRTYGGVLVEVAAIKA--HEAYNSN----SKI 119
            |:...::|||||......:    .||....|..:|.        .|.::  |..:|::    ...
  Rat    81 IAPKWLLTAAHCRKPHYVILLGEHNLEKTDGCEQRR--------MATESFPHPGFNNSLPNKDHR 137

  Fly   120 NDIGVVRLKTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDG---PSSATLLFVDTRIVGR 181
            |||.:|::.:.......::.:|::|.....|::..|||||.||:..   |.|  |...:..|:|.
  Rat   138 NDIMLVKMSSPAFITRAVRPLTLSSLCVTAGTSCLISGWGTTSSPQLRLPHS--LRCANVSIIGH 200

  Fly   182 SQCGSSTYGYGSFIKATMICAAA--TNKDACQGDSGGPLVSGGQLVGVVSWGRD-CAVANYPGVY 243
            .:|..:   |...|..||:||:.  ..||:||||||||||..|.|.|::|||:| |||...||||
  Rat   201 KECERA---YPGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVY 262

  Fly   244 ANIAELRDWVLQAQK 258
            ..:.:..||:.:..:
  Rat   263 TKVCKYFDWIHEVMR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 76/234 (32%)
Tryp_SPc 35..253 CDD:238113 75/233 (32%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 76/234 (32%)
Tryp_SPc 51..275 CDD:238113 76/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.