DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and TMPRSS11E

DIOPT Version :10

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:246 Identity:84/246 - (34%)
Similarity:119/246 - (48%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QTSSLGG--RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDT---P---TTV 83
            ::.:||.  ||||||.....:.|||.|||..|||.||.::|:...:|:||||..|   |   |..
Human   182 RSKTLGQSLRIVGGTEVEEGEWPWQASLQWDGSHRCGATLINATWLVSAAHCFTTYKNPARWTAS 246

  Fly    84 SNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASAT-- 146
            ..:.|:....||....::|       ||.|...|...||.:..|.:.:.:.:.:..:.:..|:  
Human   247 FGVTIKPSKMKRGLRRIIV-------HEKYKHPSHDYDISLAELSSPVPYTNAVHRVCLPDASYE 304

  Fly   147 --PAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAAT--NK 207
              |  |....::|:|....||.|...|......::..:.| :....|...|...|:||.:.  ..
Human   305 FQP--GDVMFVTGFGALKNDGYSQNHLRQAQVTLIDATTC-NEPQAYNDAITPRMLCAGSLEGKT 366

  Fly   208 DACQGDSGGPLVSGG-----QLVGVVSWGRDCAVANYPGVYANIAELRDWV 253
            |||||||||||||..     .|.|:||||.:||..|.||||..:..||||:
Human   367 DACQGDSGGPLVSSDARDIWYLAGIVSWGDECAKPNKPGVYTRVTALRDWI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 35..253 CDD:238113 80/234 (34%)
TMPRSS11ENP_054777.2 SEA 51..147 CDD:460188
Tryp_SPc 192..420 CDD:238113 81/236 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.