DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Prss38

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:251 Identity:76/251 - (30%)
Similarity:125/251 - (49%) Gaps:30/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 SLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHC---------LDTPTTVSN 85
            :|.|:::||..:.....|||||:..:|.|.|||||::...::|||||         .|....::|
  Rat   109 ALHGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLTAAHCFAREKRLQTFDMYVGITN 173

  Fly    86 LRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKI-NDIGVVRLKTKLTFGSTIKAITMASATPAH 149
            |.:   :||.|.   ..|:..:..|..:.....: .|:.:|:.|:.:.|...:..|.:.|   ::
  Rat   174 LEV---ANKHTQ---WFEINQVIIHPTFEMFHPVGGDVALVQSKSAIVFSDYVLPICLPS---SN 229

  Fly   150 GSAASIS----GWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAA--ATNKD 208
            .:.:.:|    |||..|..|.:...||.....::.:.|| ...||..|::...|:||.  ...|:
  Rat   230 LNLSDLSCWTTGWGMVSPQGETGKDLLEAQLPLIPKFQC-QLLYGLTSYLLPEMLCAGDIKNMKN 293

  Fly   209 ACQGDSGGPLV----SGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQAQKTV 260
            .|:||||.|||    .....:|:|||||.||...||||:||::...:|:....:|:
  Rat   294 VCEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLNWIRYNMETI 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 72/238 (30%)
Tryp_SPc 35..253 CDD:238113 72/237 (30%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 73/236 (31%)
Tryp_SPc 116..342 CDD:214473 72/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.