DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Prss34

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:281 Identity:86/281 - (30%)
Similarity:131/281 - (46%) Gaps:36/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQ------RSGSHF 59
            :.:|...||.|..|  |:.:|:..:.....:|  ||||...|....||||||:      ....|.
  Rat     3 LGMLWFLFLTLPCL--GSTMPLTPDSGQELVG--IVGGCPVSASRFPWQVSLRFYNMKLSKWEHI 63

  Fly    60 CGGSIISNNIIVTAAHCLD-TPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKIN--- 120
            ||||:|....::|||||:: .....|..|::.|..:......|::||.|..|..:  :.|::   
  Rat    64 CGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQLRLYENDQLMKVAKIIRHPKF--SEKLSAPG 126

  Fly   121 --DIGVVRLKTKLTFGSTIKAITMASATPAHGSAAS--ISGWGKTSTDG----PSSATLLFVDTR 177
              ||.:::|.:.:.....:..:::.:|:....|..:  ::|||  ..:|    |....|..|...
  Rat   127 GADIALLKLDSTVVLSERVHPVSLPAASQRISSKKTWWVAGWG--VIEGHRPLPPPCHLREVAVP 189

  Fly   178 IVGRSQCGSSTYGYGS------FIKATMICAAATNKDACQGDSGGPLVSGGQL----VGVVSWGR 232
            |||.|.|......|.|      .||..|:||....:|:||.|||||||.....    |||||||.
  Rat   190 IVGNSDCEQKYRTYSSLDRTTKIIKDDMLCAGMEGRDSCQADSGGPLVCRWNCSWVQVGVVSWGI 254

  Fly   233 DCAVANYPGVYANIAELRDWV 253
            .|.:.::||||..:.....|:
  Rat   255 GCGLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 77/246 (31%)
Tryp_SPc 35..253 CDD:238113 77/245 (31%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 78/247 (32%)
Tryp_SPc 33..275 CDD:214473 77/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.