DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Prss30

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:274 Identity:89/274 - (32%)
Similarity:126/274 - (45%) Gaps:33/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSL--QRSGSHFCGGSIISNNII 70
            ||.||.:..|     |......|..|:||||..:.....||||||  ::.| |.||||:|....:
  Rat     9 FLLLLQILTG-----GRGDILHSGAGKIVGGQDAPEGRWPWQVSLRTEKEG-HICGGSLIHEVWV 67

  Fly    71 VTAAHCLDTPTTVSNLRIRAGS---NKRTYGGVLVEVAAIKAHEAYN-SNSKINDIGVVRLKTKL 131
            :|||||...|...|...::.|.   :.......||.|..|..:..|. .::...||.::||.|.|
  Rat    68 LTAAHCFCRPLNSSFYHVKVGGLTLSLTEPHSTLVAVRNIFVYPTYLWEDASSGDIALLRLDTPL 132

  Fly   132 ---TFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQC------GSS 187
               .|.........|..||  |:...::|||.|. :...::.|..:...::....|      |.:
  Rat   133 QPSQFSPVCLPQAQAPLTP--GTVCWVTGWGATH-ERELASVLQELAVPLLDSEDCERMYHIGET 194

  Fly   188 TYGYGSFIKATMICAAAT--NKDACQGDSGGPLV----SGGQLVGVVSWGRDCAVANYPGVYANI 246
            :......|::.|:||...  .||:||||||||||    |....||:.|||..||..|.||||..:
  Rat   195 SLSGKRVIQSDMLCAGFVEGQKDSCQGDSGGPLVCAINSSWIQVGITSWGIGCARPNKPGVYTRV 259

  Fly   247 AELRDWVLQAQKTV 260
            .:..||:   |:|:
  Rat   260 PDYVDWI---QRTL 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 78/239 (33%)
Tryp_SPc 35..253 CDD:238113 78/238 (33%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.