DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Prss3b

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:266 Identity:96/266 - (36%)
Similarity:141/266 - (53%) Gaps:28/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSII 65
            |..||  |||.|    ||.:.:.|:....    :||||........|:|||| .:|.||||||:|
  Rat     1 MKALI--FLAFL----GAAVALPLDDDDD----KIVGGYTCQKNSLPYQVSL-NAGYHFCGGSLI 54

  Fly    66 SNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTY---GGVLVEVAAIKAHEAYNSNSKINDIGVVRL 127
            ::..:|:||||..     |.:::|.|.:....   |...::.|.|..|.:||:|:..|||.:::|
  Rat    55 NSQWVVSAAHCYK-----SRIQVRLGEHNIDVVEGGEQFIDAAKIIRHPSYNANTFDNDIMLIKL 114

  Fly   128 KTKLTFGSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLL-FVDTRIVGRSQCGSSTYGY 191
            .:..|..|.:..:::..:..:.|:...:||||.|.:.|.:..:|| .:|..::..|.|.||   |
  Rat   115 NSPATLNSRVSTVSLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKSS---Y 176

  Fly   192 GSFIKATMICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVL 254
            ...|.:.|.|..  ...||:||||||||:|..|||.||||||..||....||||..:....:|: 
  Rat   177 PGKITSNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKGKPGVYTKVCNYVNWI- 240

  Fly   255 QAQKTV 260
              |:||
  Rat   241 --QQTV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 82/224 (37%)
Tryp_SPc 35..253 CDD:238113 82/223 (37%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 82/224 (37%)
Tryp_SPc 25..243 CDD:238113 84/229 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.