DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Tpsg1

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:245 Identity:82/245 - (33%)
Similarity:115/245 - (46%) Gaps:25/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRA 90
            ||.|:.|.|||||.|:.....|||.||:....|.||||::|...::|||||.......|:.::..
Mouse    78 PQVSNSGSRIVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYQVHL 142

  Fly    91 GSNKRTYGGVLVEVAAIKAHEAYNSN----SKINDIGVVRLKTKLTFGSTIKAITM--ASATPAH 149
            |....|   :....:.:|....|..:    ....||.:|:|.:.:...|.::.:.:  |||....
Mouse   143 GELTVT---LSPHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLPEASADFYP 204

  Fly   150 GSAASISGWGKTSTDGP-------SSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAATNK 207
            |....::|||.|....|       ..|.:..||.:..  ||..:|.  .||.|:..|:||.... 
Mouse   205 GMQCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTC--SQAYNSP--NGSLIQPDMLCARGPG- 264

  Fly   208 DACQGDSGGPLV----SGGQLVGVVSWGRDCAVANYPGVYANIAELRDWV 253
            ||||.|||||||    ...|..||||||..|...:.|||||.:....:|:
Mouse   265 DACQDDSGGPLVCQVAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWI 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 77/235 (33%)
Tryp_SPc 35..253 CDD:238113 76/234 (32%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 77/236 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.