DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and KLK13

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:269 Identity:79/269 - (29%)
Similarity:122/269 - (45%) Gaps:30/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSII 65
            ::|:||:.  .|||:.|..........|:...|.:.||.......:|||.:|...|...|||.::
Human     4 LALVIASL--TLALSGGVSQESSKVLNTNGTSGFLPGGYTCFPHSQPWQAALLVQGRLLCGGVLV 66

  Fly    66 SNNIIVTAAHCLDTPTTV-----SNLRIRAGSNKRTYGGVLVEVAAIKAHEAY-NSNSKIN---D 121
            ....::||||||.....|     :..|:.||...|       ||.....|..| .|.:.:|   |
Human    67 HPKWVLTAAHCLKEGLKVYLGKHALGRVEAGEQVR-------EVVHSIPHPEYRRSPTHLNHDHD 124

  Fly   122 IGVVRLKTKLTFGSTIKAITMA---SATPAHGSAASISGWGKTSTDGPS-SATLLFVDTRIVGRS 182
            |.::.|::.:.....|:.:.::   ..||  |:...:||||.|::...: ..||...:.::....
Human   125 IMLLELQSPVQLTGYIQTLPLSHNNRLTP--GTTCRVSGWGTTTSPQVNYPKTLQCANIQLRSDE 187

  Fly   183 QCGSSTYGYGSFIKATMICAAAT--NKDACQGDSGGPLVSGGQLVGVVSWGR-DCAVANYPGVYA 244
            :|...   |...|...|:||...  .||:|:||||||||....|.|:||||. .|...:.||||.
Human   188 ECRQV---YPGKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDRPGVYT 249

  Fly   245 NIAELRDWV 253
            .::....|:
Human   250 RVSRYVLWI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 69/234 (29%)
Tryp_SPc 35..253 CDD:238113 69/233 (30%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 70/233 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.