DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Prss1

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_036767.1 Gene:Prss1 / 24691 RGDID:3417 Length:246 Species:Rattus norvegicus


Alignment Length:258 Identity:93/258 - (36%)
Similarity:138/258 - (53%) Gaps:24/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTA 73
            |.:|||. ||.:...||..     .:||||........|:|||| .||.||||||:|::..:|:|
  Rat     4 LLILALV-GAAVAFPLEDD-----DKIVGGYTCPEHSVPYQVSL-NSGYHFCGGSLINDQWVVSA 61

  Fly    74 AHCLDTPTTVSNLRIRAGS-NKRTYGG--VLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGS 135
            |||..     |.:::|.|. |.....|  ..:..|.|..|..|:|.:..|||.:::|.:.:...:
  Rat    62 AHCYK-----SRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNA 121

  Fly   136 TIKAITMASATPAHGSAASISGWGKTSTDGPSSATLL-FVDTRIVGRSQCGSSTYGYGSFIKATM 199
            .:..:.:.||....|:...|||||.|.::|.::..|| .||..::.::.|.::   |...|.::|
  Rat   122 RVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAA---YPGEITSSM 183

  Fly   200 ICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQAQKTV 260
            ||..  ...||:||||||||:|..|||.|:||||..||:.:.||||..:.....|:   |.|:
  Rat   184 ICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWI---QDTI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 82/224 (37%)
Tryp_SPc 35..253 CDD:238113 82/223 (37%)
Prss1NP_036767.1 Tryp_SPc 23..239 CDD:214473 82/224 (37%)
Tryp_SPc 24..242 CDD:238113 84/229 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 152 1.000 Inparanoid score I4263
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.