DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and CG30031

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_725035.1 Gene:CG30031 / 246404 FlyBaseID:FBgn0050031 Length:253 Species:Drosophila melanogaster


Alignment Length:254 Identity:150/254 - (59%)
Similarity:190/254 - (74%) Gaps:7/254 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISN 67
            |.....|:.:|...|..:|.||.||   |.||||||:|::|...|||:||||||||.|||||.|:
  Fly     2 LKFVILLSAVACALGGTVPEGLLPQ---LDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSS 63

  Fly    68 NIIVTAAHCLDTPTTVSNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLT 132
            |:||||||||.: .:.|.|:|||||:..:.|||...|::.|.||.||:|:.:|||.::::...||
  Fly    64 NVIVTAAHCLQS-VSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALT 127

  Fly   133 FGSTIKAITMASATPAHGSAASISGWGKTSTDGPSS--ATLLFVDTRIVGRSQCGSSTYGYGSFI 195
            |.||||||.:||:.||:|:|||:|||| |.:.|.||  :.|.:|:..||.:|||.||||||||.|
  Fly   128 FSSTIKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQI 191

  Fly   196 KATMICAAATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVL 254
            ::|||||||:.||||||||||||||||.||||||||..||.:|||||||::|.||.||:
  Fly   192 RSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 137/220 (62%)
Tryp_SPc 35..253 CDD:238113 136/219 (62%)
CG30031NP_725035.1 Tryp_SPc 30..249 CDD:214473 137/220 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443160
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3969
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
109.900

Return to query results.
Submit another query.