DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Try4

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_035776.1 Gene:Try4 / 22074 MGIID:102757 Length:246 Species:Mus musculus


Alignment Length:260 Identity:91/260 - (35%)
Similarity:137/260 - (52%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVT 72
            ||||:    ||.:...::..     .:||||........|:|||| .||.||||||:|::..:|:
Mouse     6 FLALV----GAAVAFPVDDD-----DKIVGGYTCRENSVPYQVSL-NSGYHFCGGSLINDQWVVS 60

  Fly    73 AAHCLDTPTTV----SNLRIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTF 133
            ||||..:...|    .|:.:..|:.:      .|..|.|..|..:||.:..|||.:::|.:.:|.
Mouse    61 AAHCYKSRIQVRLGEHNINVLEGNEQ------FVNSAKIIKHPNFNSRTLNNDIMLIKLASPVTL 119

  Fly   134 GSTIKAITMASATPAHGSAASISGWGKTSTDGPSSATLL-FVDTRIVGRSQCGSSTYGYGSFIKA 197
            .:.:..:.:.|:....|:...|||||.|.:.|.::..|| .:|..::.::.|.:|   |...|..
Mouse   120 NARVATVALPSSCAPAGTQCLISGWGNTLSFGVNNPDLLQCLDAPLLPQADCEAS---YPGKITN 181

  Fly   198 TMICAA--ATNKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAELRDWVLQAQKTV 260
            .|||..  ...||:||||||||:|..|||.|:||||..||:.:.||||..:....||:   |.|:
Mouse   182 NMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWI---QNTI 243

  Fly   261  260
            Mouse   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 82/225 (36%)
Tryp_SPc 35..253 CDD:238113 82/224 (37%)
Try4NP_035776.1 Tryp_SPc 23..239 CDD:214473 82/225 (36%)
Tryp_SPc 24..242 CDD:238113 84/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.