DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Prss38

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001038986.1 Gene:Prss38 / 216797 MGIID:2685095 Length:322 Species:Mus musculus


Alignment Length:240 Identity:81/240 - (33%)
Similarity:119/240 - (49%) Gaps:24/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LGGRIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAG---- 91
            |.|:::||..:.....||||||..||.|.|||||:|...:::||||.|....:....|..|    
Mouse    52 LQGKLLGGEFARDRKWPWQVSLHYSGFHICGGSILSAYWVLSAAHCFDRGKKLETYDIYVGITNL 116

  Fly    92 --SNKRTYGGVLVEVAAIKAHEAYNSNSKI-NDIGVVRLKTKLTFGSTIKAITMASATPAHGSAA 153
              :|:.|.   ..|:..:..|..:.....| .|:.:|:||:.:.|...:..|.:   .|:.....
Mouse   117 EKANRHTQ---WFEIYQVIIHPTFQMYHPIGGDVALVQLKSAIVFSDFVLPICL---PPSDLYLI 175

  Fly   154 SIS----GWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAA--ATNKDACQG 212
            ::|    |||..|..|.:...||.....::.|.|| ...||..|::...|:|||  .|.|:.|:|
Mouse   176 NLSCWTTGWGMISPQGETGNELLEAQLPLIPRFQC-QLLYGLSSYLLPEMLCAADIKTMKNVCEG 239

  Fly   213 DSGGPLVSGGQ----LVGVVSWGRDCAVANYPGVYANIAELRDWV 253
            |||.|||....    .:|:|||||.||...||||:||::....|:
Mouse   240 DSGSPLVCKQNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLSWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 78/235 (33%)
Tryp_SPc 35..253 CDD:238113 78/234 (33%)
Prss38NP_001038986.1 Tryp_SPc 58..287 CDD:238113 79/234 (34%)
Tryp_SPc 58..284 CDD:214473 78/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.