DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Tmprss4

DIOPT Version :10

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_663378.1 Gene:Tmprss4 / 214523 MGIID:2384877 Length:435 Species:Mus musculus


Alignment Length:83 Identity:17/83 - (20%)
Similarity:34/83 - (40%) Gaps:10/83 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 YKIHRFFFTNDQYSIVIFVRNRVSNYFTQIGIQFYENQPKSQLSVIIVPIAFGLL--AVLMVVFG 534
            |.:..:.|:  ...::.|:.:.|.:..|.:.:...||.....|.:      |.||  :||:.:|.
Mouse     9 YSLWEYLFS--WVGLIFFLLDIVMDILTVVSLYQQENYVSMGLMI------FFLLGSSVLLQIFS 65

  Fly   535 MAYYIQNRDRFIVEVADF 552
            ..:|..:......:|..|
Mouse    66 WVWYSDSLHELETKVEKF 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 35..253 CDD:238113
Tmprss4NP_663378.1 LDLa 56..90 CDD:238060 6/28 (21%)
SRCR_2 106..195 CDD:470597
Tryp_SPc 202..427 CDD:214473
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.