DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Prss27

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_780649.1 Gene:Prss27 / 213171 MGIID:2450123 Length:328 Species:Mus musculus


Alignment Length:245 Identity:82/245 - (33%)
Similarity:123/245 - (50%) Gaps:27/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGSNKRTYG 98
            |:|||..:...:.|||||:||:|.||||||:|:...::|||||....:.:|..::..|:.|....
Mouse    37 RMVGGENALEGEWPWQVSIQRNGIHFCGGSLIAPTWVLTAAHCFSNTSDISIYQVLLGALKLQQP 101

  Fly    99 G---VLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITMASATPAHGSAAS--ISGW 158
            |   :.|.|..:|::..|...:...|:.:|.|:..:||.:.|..:.:...:....|..:  ::||
Mouse   102 GPHALYVPVKQVKSNPQYQGMASSADVALVELQGPVTFTNYILPVCLPDPSVIFESGMNCWVTGW 166

  Fly   159 GKTSTDG--PSSATLLFVDTRIVGRSQCG-------SSTYGYGSFIKATMICA--AATNKDACQG 212
            |..|...  |:...|..:...|:...:|.       .|.:...: ||..|:||  |...||||:|
Mouse   167 GSPSEQDRLPNPRVLQKLAVPIIDTPKCNLLYNKDVESDFQLKT-IKDDMLCAGFAEGKKDACKG 230

  Fly   213 DSGGPLVSGGQLV-------GVVSWGRDCAVANYPGVYANIAELRDWVLQ 255
            |||||||.   ||       ||:|||..||..|.||||..:.....|:.|
Mouse   231 DSGGPLVC---LVDQSWVQAGVISWGEGCARRNRPGVYIRVTSHHKWIHQ 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 80/241 (33%)
Tryp_SPc 35..253 CDD:238113 79/240 (33%)
Prss27NP_780649.1 Tryp_SPc 37..275 CDD:214473 80/241 (33%)
Tryp_SPc 39..278 CDD:238113 81/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.