DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Tpsb2

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:270 Identity:90/270 - (33%)
Similarity:128/270 - (47%) Gaps:26/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQ---RSGSHFCGGSI 64
            ||:...|:|||    :::.....|....:|  ||||..:|....||||||:   ....||||||:
Mouse     6 LLLLWALSLLA----SLVYSAPRPANQRVG--IVGGHEASESKWPWQVSLRFKLNYWIHFCGGSL 64

  Fly    65 ISNNIIVTAAHCLDTPTTVSNL-RIRAGSNKRTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLK 128
            |....::|||||:........| |::.......||..|:.:..|..|..|.:.....|:.::.|:
Mouse    65 IHPQWVLTAAHCVGPHIKSPQLFRVQLREQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELE 129

  Fly   129 TKLTFGSTIKAITM--ASATPAHGSAASISGWGKTSTDG--PSSATLLFVDTRIVGRSQCGSSTY 189
            ..:...:.:..|::  ||.|...|::..::|||....|.  |....|..|...||..|.| ...|
Mouse   130 VPVNVSTHLHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQVKVPIVENSLC-DRKY 193

  Fly   190 GYGSF-------IKATMICAAATNKDACQGDSGGPL---VSGGQL-VGVVSWGRDCAVANYPGVY 243
            ..|.:       :...|:||..|.:|:|||||||||   |.|..| .||||||..||..|.||:|
Mouse   194 HTGLYTGDDFPIVHDGMLCAGNTRRDSCQGDSGGPLVCKVKGTWLQAGVVSWGEGCAQPNKPGIY 258

  Fly   244 ANIAELRDWV 253
            ..:....||:
Mouse   259 TRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 81/237 (34%)
Tryp_SPc 35..253 CDD:238113 81/236 (34%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 82/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.