DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ser8 and Gzmm

DIOPT Version :9

Sequence 1:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_032530.1 Gene:Gzmm / 16904 MGIID:99549 Length:264 Species:Mus musculus


Alignment Length:231 Identity:74/231 - (32%)
Similarity:119/231 - (51%) Gaps:16/231 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RIVGGTASSIEDRPWQVSLQRSGSHFCGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGSNK---- 94
            :|:||..:....||:..|||::.||.|||.::....::||||||..|  :.||::..|.:.    
Mouse    26 QIIGGREAVPHSRPYMASLQKAKSHVCGGVLVHRKWVLTAAHCLSEP--LQNLKLVLGLHNLHDL 88

  Fly    95 RTYGGVLVEVAAIKAHEAYNSNSKINDIGVVRLKTKLTFGSTIKAITM---ASATPAHGSAASIS 156
            :..|.......||| |..||...: ||:.:::|..::.....:|.:.:   ..:.||.|:..|.:
Mouse    89 QDPGLTFYIREAIK-HPGYNHKYE-NDLALLKLDRRVQPSKNVKPLALPRKPRSKPAEGTWCSTA 151

  Fly   157 GWGKTSTDGPSSATLLFVDTRIVGRSQCGSSTYGYGSFIKATMICAAATNKD--ACQGDSGGPLV 219
            |||.|...||.:..|..:|.|::....|.:|.:..|..|. :|:|..|.:|.  .|:||||||||
Mouse   152 GWGMTHQGGPRARALQELDLRVLDTQMCNNSRFWNGVLID-SMLCLKAGSKSQAPCKGDSGGPLV 215

  Fly   220 SG-GQLVGVVSW-GRDCAVANYPGVYANIAELRDWV 253
            .| ||:.|::|: .:.|.....|.|...:|....|:
Mouse   216 CGKGQVDGILSFSSKTCTDIFKPPVATAVAPYSSWI 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 73/229 (32%)
Tryp_SPc 35..253 CDD:238113 73/228 (32%)
GzmmNP_032530.1 Tryp_SPc 27..254 CDD:238113 74/230 (32%)
Tryp_SPc 27..251 CDD:214473 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6163
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.